PDB entry 2fup

View 2fup on RCSB PDB site
Description: Crystal structure of a putative flagella synthesis protein flgN (NP_252042.1) from Pseudomonas aeruginosa at 1.48 A resolution.
Class: structural genomics, unknown function
Keywords: np_252042.1, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2006-01-27, released 2006-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.19
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA3352
    Species: Pseudomonas aeruginosa
    Gene: np_252042.1
    Database cross-references and differences (RAF-indexed):
    • GB NP_252042 (1-End)
      • modified residue (1)
      • modified residue (51)
    Domains in SCOP 1.75: d2fupa1
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fupA (A:)
gmpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngr
araeilreagvsldreglaryareradgaellargdelgellercqqanlrngriiranq
astgsllnilrgqdapslydsrggtasssrqrplsqa

    Sequence, based on observed residues (ATOM records): (download) 
    >2fupA (A:)
mpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngra
raeilreagvsldreglaryareradgaellargdelgellercqqanlrngrianqast
gsllnilr