PDB entry 2fun

View 2fun on RCSB PDB site
Description: alternative p35-caspase-8 complex
Class: apoptosis/hydrolase
Keywords: apoptosis/hydrolase
Deposited on 2006-01-27, released 2006-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Early 35 kDa protein
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: P35
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2funa_
  • Chain 'B':
    Compound: caspase-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2funb_
  • Chain 'C':
    Compound: Early 35 kDa protein
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: P35
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2func_
  • Chain 'D':
    Compound: caspase-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fund_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2funA (A:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2funA (A:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdikyfkdehysvscqngsvlkskfakilkshdytd
    kksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfahei
    ndtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksmiykal
    efttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2funB (B:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetdseeqpylemdlsspqtryipdeadfll
    gmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgk
    qmpqptftlrkklvfpsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2funB (B:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetdtryipdeadfllgmatvnncvsyrnpa
    egtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkqmpqptftlrkklvf
    psd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2funC (C:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2funC (C:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdikyfkdehysvscqngsvlkskfakilkshdytd
    kksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfahei
    ndtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksmiykal
    efttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2funD (D:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetdseeqpylemdlsspqtryipdeadfll
    gmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgk
    qmpqptftlrkklvfpsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2funD (D:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetdtryipdeadfllgmatvnncvsyrnpa
    egtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkqmpqptftlrkklvf
    p