PDB entry 2fuj

View 2fuj on RCSB PDB site
Description: A putative acyl-CoA thioesterase from Xanthomonas campestris (XC229)
Class: hydrolase
Keywords: Xanthomonas campestris, structural genomics, conserved hypothetical protein, hot dog domain, acyl-CoA thioesterase, HYDROLASE
Deposited on 2006-01-27, released 2006-07-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.242
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2fuja1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fujA (A:)
    snamsehkilarvpisvrwrdmdsmghvnnakyisyleearvrwmlgvegvamtdriapv
    vaatnvnykrplvwpndilvelfverlgsssvtighrildqkdegvlysdgnvvvvwidt
    qtgksaslpdavraass
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fujA (A:)
    kilarvpisvrwrdmdsmghvnnakyisyleearvrwmlgvegvamtdriapvvaatnvn
    ykrplvwpndilvelfverlgsssvtighrildqkdegvlysdgnvvvvwidtqtgks