PDB entry 2fuf

View 2fuf on RCSB PDB site
Description: Crystal structure of the SV40 large T antigen origin-binding domain
Class: DNA binding protein
Keywords: Replication origin binding domain, dna replication, DNA BINDING PROTEIN
Deposited on 2006-01-26, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: SV40 A GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03070 (2-End)
      • modified residue (47)
      • modified residue (103)
    Domains in SCOPe 2.08: d2fufa_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fufA (A:)
    gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
    synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
    pgglkehdfnpess
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fufA (A:)
    kvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsy
    nhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpg
    glkehd