PDB entry 2fud

View 2fud on RCSB PDB site
Description: Human Cathepsin S with Inhibitor CRA-27566
Class: hydrolase
Keywords: cysteine protease, proteinase, papain, 27566, HYDROLASE
Deposited on 2006-01-26, released 2006-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fuda_
  • Chain 'B':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fudb_
  • Heterogens: CRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fudA (A:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fudA (A:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fudB (B:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fudB (B:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei