PDB entry 2fuc

View 2fuc on RCSB PDB site
Description: Human alpha-Phosphomannomutase 1 with Mg2+ cofactor bound
Class: isomerase
Keywords: Phosphomannomutase, protein glycosylation, carbohydrate-deficient glycoprotein syndrome, Haloalkanoic Acid Dehalogenase Superfamily, ISOMERASE
Deposited on 2006-01-26, released 2006-03-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphomannomutase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92871
      • modified residue (115)
      • modified residue (134)
      • modified residue (185)
    Domains in SCOPe 2.06: d2fuca1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fucA (A:)
    mavtaqaarrkervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckia
    eqlgdgdeviekfdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallr
    lpkkrgtfiefrngmlnispigrsctleeriefseldkkekirekfvealktefagkglr
    fsrggmisfdvfpegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsv
    vspqdtvqrcreiffpetahea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fucA (A:)
    ervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckiaeqlgdgdevie
    kfdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallrlpkkrgtfief
    rngmlnispigrsctleeriefseldkkekirekfvealktefagkglrfsrggmisfdv
    fpegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsvvspqdtvqrcr
    eiffp