PDB entry 2fua

View 2fua on RCSB PDB site
Description: l-fuculose 1-phosphate aldolase crystal form t with cobalt
Deposited on 1996-02-14, released 1996-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2fua__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fua_ (-)
    mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
    ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
    nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
    ylttlaitdpvpvlsdeeiavvlekfktyg