PDB entry 2fu9

View 2fu9 on RCSB PDB site
Description: Zinc-beta-lactamase L1 from stenotrophomonas maltophilia (mp2 inhibitor complex)
Class: hydrolase
Keywords: hydrolase, zn, metallo, beta, lactamase, inhibitor
Deposited on 2006-01-26, released 2007-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.151
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase L1
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fu9a_
  • Chain 'B':
    Compound: Metallo-beta-lactamase L1
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fu9b_
  • Heterogens: ZN, SO4, MP2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fu9A (A:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fu9A (A:)
    evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
    hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
    lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
    yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
    kaltckayadaaeqkfdgqlaketag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fu9B (B:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fu9B (B:)
    evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
    hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
    lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
    yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
    kaltckayadaaeqkfdgqlaketag