PDB entry 2fu6

View 2fu6 on RCSB PDB site
Description: Zinc-beta-lactamase l1 from stenotrophomonas maltophilia (apo form)
Class: hydrolase
Keywords: hydrolase, metallo, zn, lactamase
Deposited on 2006-01-26, released 2007-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.163
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase L1
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fu6a_
  • Chain 'B':
    Compound: Metallo-beta-lactamase L1
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fu6b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fu6A (A:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fu6A (A:)
    evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
    hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
    lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
    yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
    kaltckayadaaeqkfdgqlaketag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fu6B (B:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fu6B (B:)
    evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
    hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
    lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
    yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
    kaltckayadaaeqkfdgqlaketag