PDB entry 2fu3

View 2fu3 on RCSB PDB site
Description: Crystal structure of gephyrin E-domain
Class: biosynthetic protein/structural protein
Keywords: Glycine receptor, gephyrin, neuroreceptor anchoring
Deposited on 2006-01-25, released 2006-03-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-04-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gephyrin
    Species: Rattus norvegicus
    Gene: Rattus norvegicus (Norway rat)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fu3a1, d2fu3a2, d2fu3a3
  • Chain 'B':
    Compound: gephyrin
    Species: Rattus norvegicus
    Gene: Rattus norvegicus (Norway rat)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fu3b1, d2fu3b2, d2fu3b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fu3A (A:)
    mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
    vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
    dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
    fpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllna
    lnegisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgv
    rkiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrci
    ltwhhqeplpwaqstgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fu3A (A:)
    mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
    vraadgpgdrfiigtvmpgqvmrvttgapipcgadavvqvedtelireseelevrilvqa
    rpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkfpvvavmstgnell
    npeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnalnegisradviits
    ggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvrkiifalpgnpvsa
    vvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrciltwhhqeplpwaqs
    tgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fu3B (B:)
    mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
    vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
    dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
    fpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllna
    lnegisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgv
    rkiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrci
    ltwhhqeplpwaqstgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl