PDB entry 2fty

View 2fty on RCSB PDB site
Description: Crystal structure of dihydropyrimidinase from Saccharomyces kluyveri
Class: Hydrolase
Keywords: alpha/beta barrel, beta-sandwich, Hydrolase
Deposited on 2006-01-25, released 2006-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropyrimidinase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: pyd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P903 (0-End)
      • modified residue (165)
    Domains in SCOPe 2.07: d2ftya1, d2ftya2
  • Chain 'B':
    Compound: dihydropyrimidinase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: pyd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P903 (0-End)
      • modified residue (165)
    Domains in SCOPe 2.07: d2ftyb1, d2ftyb2
  • Chain 'C':
    Compound: dihydropyrimidinase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: pyd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P903 (0-End)
      • modified residue (165)
    Domains in SCOPe 2.07: d2ftyc1, d2ftyc2
  • Chain 'D':
    Compound: dihydropyrimidinase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: pyd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P903 (0-End)
      • modified residue (165)
    Domains in SCOPe 2.07: d2ftyd1, d2ftyd2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ftyA (A:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchhhgeves
    ygvgidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcs
    ynyyektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklv
    eiqctnpakvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdyt
    pfegieiknwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    spgddddkhhhhhhhhsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftyA (A:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchgvgidls
    sisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcsynyyekts
    taskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklveiqctnpa
    kvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdytpfegieik
    nwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ftyB (B:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchhhgeves
    ygvgidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcs
    ynyyektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklv
    eiqctnpakvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdyt
    pfegieiknwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    spgddddkhhhhhhhhsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftyB (B:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchgvgidls
    sisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcsynyyekts
    taskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklveiqctnpa
    kvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdytpfegieik
    nwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ftyC (C:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchhhgeves
    ygvgidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcs
    ynyyektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklv
    eiqctnpakvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdyt
    pfegieiknwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    spgddddkhhhhhhhhsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftyC (C:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrcgvgidlss
    isespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcsynyyektst
    askhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklveiqctnpak
    vygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdytpfegieikn
    wprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ftyD (D:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchhhgeves
    ygvgidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcs
    ynyyektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklv
    eiqctnpakvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdyt
    pfegieiknwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    spgddddkhhhhhhhhsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftyD (D:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchgidlssi
    sespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcsynyyektsta
    skhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklveiqctnpakv
    ygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdytpfegieiknw
    prytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye