PDB entry 2ftx

View 2ftx on RCSB PDB site
Description: Crystal structure of the yeast kinetochore Spc24/Spc25 globular domain
Class: structural protein, protein binding
Keywords: alpha-beta, complex, coiled-coil, structural protein, protein binding
Deposited on 2006-01-25, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: YER018C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40014 (1-89)
    • initiating methionine (0)
    • modified residue (43)
    • modified residue (84)
  Domains in SCOPe 2.08: d2ftxa1
• Chain 'B':
  Compound: Hypothetical 24.6 kDa protein in ILV2-ADE17 intergenic region
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: YMR117C, YM9718.16C
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q04477 (Start-63)
  Domains in SCOPe 2.08: d2ftxb1
• Heterogens: NA, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ftxA (A:)
  mndaaevalyerllqlrvlpgasdvhdvrfvfgddsrcwievamhgdhvignshpaldpk
  sratlehvltvqgdlaaflvvardmllasl
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2ftxB (B:)
  gshmeanenilklklyrslgvildlendqvlinrkndgnidilpldnnlsdfyktkyiwe
  rlgk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ftxB (B:)
  anenilklklyrslgvildlendqvlinrkndgnidilpldnnlsdfyktkyiwerlgk