PDB entry 2ftw

View 2ftw on RCSB PDB site
Description: Crystal structure of dihydropyrimidinase from dictyostelium discoideum
Class: Hydrolase
Keywords: (BETA-ALPHA)8-BARREL, BETA-SANDWICH, Hydrolase
Deposited on 2006-01-25, released 2006-03-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropyrimidine amidohydrolase
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: pyd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86LT2
      • modified residue (157)
    Domains in SCOPe 2.04: d2ftwa1, d2ftwa2
  • Heterogens: ZN, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ftwA (A:)
    mlrvdqtgtilikngtvvnddryfksdvlvengiikeiskniepkegikvvdatdklllp
    ggidththfqlpfmgtvsvddfdigtqaavaggttfiidfviptrgqslleaydqwkkwa
    dekvncdyslhvaitwwseqvsremeilvkergvnsfkcfmayknsfmvtdqemyhifkr
    ckelgaiaqvhaengdmvfegqkkmlemgitgpeghelsrpealeaeatnraiviadsvc
    tpvyivhvqsigaadvickhrkegvrvygepiaaglgvdgshmwnhdwrhaaafvmgppi
    rpdprtkgvlmdylargdldcvgtdnctfcadqkamgkddftkipngvngvedrmsivwe
    ngvntgkltwcqfvratsserarifniyprkgridvgcdgdiviwdpnqsktiskdthhh
    avdfnifegikvtgiavttivagnivwsdnklscvkgsgrfvprppfgpvfdgieqrdkv
    rnellrkvdrkpyeddntknsskpgddddkhhhhhhhhsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftwA (A:)
    tgtilikngtvvnddryfksdvlvengiikeiskniepkegikvvdatdklllpggidth
    thfqlpfmgtvsvddfdigtqaavaggttfiidfviptrgqslleaydqwkkwadekvnc
    dyslhvaitwwseqvsremeilvkergvnsfkcfmayknsfmvtdqemyhifkrckelga
    iaqvhaengdmvfegqkkmlemgitgpeghelsrpealeaeatnraiviadsvctpvyiv
    hvqsigaadvickhrkegvrvygepiaaglgvdgshmwnhdwrhaaafvmgppirpdprt
    kgvlmdylargdldcvgtdnctfcadqkamgkddftkipngvngvedrmsivwengvntg
    kltwcqfvratsserarifniyprkgridvgcdgdiviwdpnqsktiskdthhhavdfni
    fegikvtgiavttivagnivwsdnklscvkgsgrfvprppfgpvfdgieqrdkvrnellr
    kvdr