PDB entry 2ftu

View 2ftu on RCSB PDB site
Description: solution structure of domain 3 of RAP
Class: lipid binding protein
Keywords: domain 3; RAP; receptor-associated protein, LIPID BINDING PROTEIN
Deposited on 2006-01-24, released 2006-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-2-macroglobulin receptor-associated protein, domain 3
    Species: Homo sapiens [TaxId:9606]
    Gene: LRPAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ftua1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ftuA (A:)
    rvshqgysteaefeeprvidlwdlaqsanltdkeleafreelkhfeakiekhnhyqkqle
    iaheklrhaesvgdgervsrsrekhallegrtkelgytvkkhlqdlsgrisrarhnel