PDB entry 2fts

View 2fts on RCSB PDB site
Description: Crystal structure of the glycine receptor-gephyrin complex
Class: structural protein
Keywords: Glycine receptor, gephyrin, neuroreceptor anchoring, STRUCTURAL PROTEIN
Deposited on 2006-01-24, released 2006-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gephyrin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rattus norvegicus (Norway rat)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ftsa1, d2ftsa2, d2ftsa3
  • Chain 'P':
    Compound: Glycine receptor beta chain precursor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Glrb
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ftsA (A:)
    mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
    vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
    dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
    fpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllna
    lnegisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgv
    rkiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrci
    ltwhhqeplpwaqstgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl
    

  • Chain 'P':
    No sequence available.