PDB entry 2ftn

View 2ftn on RCSB PDB site
Description: E. coli thymidylate synthase Y94F mutant
Class: transferase
Keywords: methyltransferase, TRANSFERASE
Deposited on 2006-01-24, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.183
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: thyA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A884 (0-263)
      • modified residue (0)
      • engineered (93)
    Domains in SCOPe 2.07: d2ftna_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ftnA (A:)
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvfgkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai