PDB entry 2ftm
View 2ftm on RCSB PDB site
Description: Crystal structure of trypsin complexed with the BPTI variant (Tyr35->Gly)
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEASE-INHIBITOR COMPLEX, hydrolase-hydrolase inhibitor COMPLEX
Deposited on
2006-01-24, released
2006-02-14
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-27, with a file datestamp of
2011-07-22.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.207
AEROSPACI score: 0.55
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cationic trypsin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P00760 (0-215)
- engineered mutation (96)
- microheterogeneity (96)
Domains in SCOPe 2.04: d2ftma_ - Chain 'B':
Compound: pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2ftmb_ - Heterogens: NA, SO4, CA, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2ftmA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaasldsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2ftmB (B:)
rpdfcleppytgpckariiryfynakaglcqtfvgggcrakrnnfksaedcmrtcgga