PDB entry 2ftk

View 2ftk on RCSB PDB site
Description: berylloflouride Spo0F complex with Spo0B
Class: transferase
Keywords: Sporulation, Spo0F, Spo0B phosphorelay
Deposited on 2006-01-24, released 2006-07-18
The last revision prior to the SCOP 1.75 freeze date was dated 2006-07-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.232
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sporulation initiation phosphotransferase b
    Species: Bacillus subtilis
    Gene: spo0B, spo0D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ftka1
  • Chain 'B':
    Compound: sporulation initiation phosphotransferase b
    Species: Bacillus subtilis
    Gene: spo0B, spo0D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ftkb1
  • Chain 'C':
    Compound: sporulation initiation phosphotransferase b
    Species: Bacillus subtilis
    Gene: spo0B, spo0D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ftkc1
  • Chain 'D':
    Compound: sporulation initiation phosphotransferase b
    Species: Bacillus subtilis
    Gene: spo0B, spo0D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ftkd1
  • Chain 'E':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • engineered (12)
      • modified residue (53)
    Domains in SCOP 1.75: d2ftke1
  • Chain 'F':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • engineered (12)
      • modified residue (53)
    Domains in SCOP 1.75: d2ftkf1
  • Chain 'G':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • engineered (12)
      • modified residue (53)
    Domains in SCOP 1.75: d2ftkg1
  • Chain 'H':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06628
      • engineered (12)
      • modified residue (53)
    Domains in SCOP 1.75: d2ftkh1
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ftkA (A:)
    mkdvsknqeenisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvi
    dakhesklsnlktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhl
    fdqavsresenhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfei
    tsheclieigld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftkA (A:)
    isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl
    ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen
    hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ftkB (B:)
    mkdvsknqeenisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvi
    dakhesklsnlktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhl
    fdqavsresenhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfei
    tsheclieigld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftkB (B:)
    nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
    lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
    nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
    ld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ftkC (C:)
    mkdvsknqeenisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvi
    dakhesklsnlktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhl
    fdqavsresenhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfei
    tsheclieigld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftkC (C:)
    isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl
    ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen
    hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
    d
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ftkD (D:)
    mkdvsknqeenisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvi
    dakhesklsnlktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhl
    fdqavsresenhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfei
    tsheclieigld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftkD (D:)
    nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
    lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
    nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
    ld
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ftkE (E:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftkE (E:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ftkF (F:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftkF (F:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ftkG (G:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftkG (G:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ftkH (H:)
    mmnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ftkH (H:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl