PDB entry 2ft9

View 2ft9 on RCSB PDB site
Description: Crystal structure of axolotl (Ambystoma mexicanum) liver bile acid-binding protein bound to cholic acid
Class: lipid binding protein
Keywords: liver bile acid-binding protein, liver basic fatty acid-binding protein, axolotl, cholic acid, LIPID BINDING PROTEIN
Deposited on 2006-01-24, released 2006-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.26
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid-binding protein 2, liver
  Species: Ambystoma mexicanum [TaxId:8296]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81400 (0-124)
  Domains in SCOPe 2.08: d2ft9a1
• Heterogens: CHD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ft9A (A:)
  pfngtwqvysqenyeaflravglpediinvakdinpiieiqqngdnfvvtsktpnqsvtn
  sftigkeaeitsmggkkikctvvleggklvsktdqfshiqevkgnemvetltvggatlir
  rskrv