PDB entry 2ft6

View 2ft6 on RCSB PDB site
Description: Structure of Cu(II)azurin with the metal-binding loop sequence "CTFPGHSALM" replaced with "CTPHPM"
Class: electron transport
Keywords: Blue copper-binding protein, greek-key beta-barrel, ELECTRON TRANSPORT
Deposited on 2006-01-24, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ft6a_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ft6A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctphpmkgt
    ltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ft6A (A:)
    csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
    gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctphpmkgtlt
    lk