PDB entry 2fsz

View 2fsz on RCSB PDB site
Description: A second binding site for hydroxytamoxifen within the coactivator-binding groove of estrogen receptor beta
Class: hormone/growth factor
Keywords: nuclear hormone binding domain, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-01-23, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.274
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92731
      • engineered (77)
      • engineered (112)
    Domains in SCOPe 2.07: d2fsza_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92731
      • engineered (77)
      • engineered (112)
    Domains in SCOPe 2.07: d2fszb_
  • Heterogens: OHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fszA (A:)
    ellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakki
    pgfvelslfdqvrllesswmevlmmglmwrsidhpgklifapdlvldrdegksvegilei
    fdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtda
    lvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmksknvvpvydlllemln
    ahvlrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fszA (A:)
    speqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvels
    lfdqvrllesswmevlmmglmwrsidhpgklifapdlvldrdegksvegileifdmllat
    tsrfrelklqhkeylcvkamillnssmsrklahllnavtdalvwviaksgissqqqsmrl
    anllmllshvrhasnkgmehllnmnvvpvydlllemlnahvlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fszB (B:)
    ellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakki
    pgfvelslfdqvrllesswmevlmmglmwrsidhpgklifapdlvldrdegksvegilei
    fdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtda
    lvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmksknvvpvydlllemln
    ahvlrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fszB (B:)
    ldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgf
    velslfdqvrllesswmevlmmglmwrsidhpgklifapdlvldrdegksvegileifdm
    llattsrfrelklqhkeylcvkamillnssmsrklahllnavtdalvwviaksgissqqq
    smrlanllmllshvrhasnkgmehllnmnvvpvydlllemlnahvlr