PDB entry 2fsw

View 2fsw on RCSB PDB site
Description: Crystal Structure of the Putative Transcriptional Regualator, MarR family from Porphyromonas gingivalis W83
Class: transcription
Keywords: alpha-beta structure, helix-turn-helix, winged-helix-turn-heix, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2006-01-23, released 2006-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.208
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PG_0823 protein
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG_0823
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M7B7 (Start-106)
      • modified residue (18)
      • modified residue (54)
      • modified residue (103)
    Domains in SCOPe 2.08: d2fswa1
  • Chain 'B':
    Compound: PG_0823 protein
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG_0823
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M7B7 (Start-106)
      • modified residue (18)
      • modified residue (54)
      • modified residue (103)
    Domains in SCOPe 2.08: d2fswb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fswA (A:)
snamerkisdeecpvrksmqifagkwtlliifqinrriirygelkraipgisekmlidel
kflcgkglikkkqypevpprveysltplgekvlpiideiakfgmenl

    Sequence, based on observed residues (ATOM records): (download) 
    >2fswA (A:)
rkisdeecpvrksmqifagkwtlliifqinrriirygelkraipgisekmlidelkflcg
kglikkkqypevpprveysltplgekvlpiideiakfgmenl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2fswB (B:)
snamerkisdeecpvrksmqifagkwtlliifqinrriirygelkraipgisekmlidel
kflcgkglikkkqypevpprveysltplgekvlpiideiakfgmenl

    Sequence, based on observed residues (ATOM records): (download) 
    >2fswB (B:)
erkisdeecpvrksmqifagkwtlliifqinrriirygelkraipgisekmlidelkflc
gkglikkkqypevpprveysltplgekvlpiideiakfgmenl