PDB entry 2fsu

View 2fsu on RCSB PDB site
Description: Crystal Structure of the PhnH Protein from Escherichia Coli
Class: structural genomics, unknown function
Keywords: C-P Lyase, PhnH, phosphonate metabolism, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, UNKNOWN FUNCTION
Deposited on 2006-01-23, released 2007-03-27
The last revision prior to the SCOP 1.75 freeze date was dated 2009-01-20, with a file datestamp of 2009-01-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein phnH
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16686 (Start-209)
      • modified residue (40)
      • modified residue (150)
      • modified residue (163)
    Domains in SCOP 1.75: d2fsua1
  • Heterogens: NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fsuA (A:)
    mrgshhhhhhgsgsmgmtletafmlpvqdaqhsfrrllkamsepgvivalhqlkrgwqpl
    niattsvlltladndtpvwlstplnndivnqslrfhtnaplvsqpeqatfavtdeaisse
    qlnalstgtavapeagatlilqvaslsggrmlrltgagiaeermiapqlpecilhelter
    phpfplgidliltcgerllaiprtthvevc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fsuA (A:)
    qdaqhsfrrllkamsepgvivalhqlkrgwqplniattsvlltladndtpvwlstplnnd
    ivnqslrfhtnaplvsqpeqatfavtdeaisseqlnalsgatlilqvaslsggrmlrltg
    eermiapqlpecilhelterphpfplgidliltcgerllaiprtthvevc