PDB entry 2fsq

View 2fsq on RCSB PDB site
Description: Crystal Structure of the Conserved Protein of Unknown Function ATU0111 from Agrobacterium tumefaciens str. C58
Class: structural genomics, unknown function
Keywords: alpha-beta barrel, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-01-23, released 2006-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.158
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Atu0111 protein
    Species: Agrobacterium tumefaciens
    Gene: atu0111
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UJ27
      • modified residue (68)
      • modified residue (84)
      • modified residue (132)
      • modified residue (142)
      • modified residue (144)
      • modified residue (200)
      • modified residue (217)
      • modified residue (228)
    Domains in SCOP 1.73: d2fsqa1
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fsqA (A:)
    ghmhaplvskdldyistanhdqpprhlgsrfsaegeflpepgntvvchlvegsqtesaiv
    strqrfldmpeasqlaftpvsslhmtvfqgviesrralpywpqtlpldtpidavtdyyrd
    rlstfptlpafnmrvtglrpvgmvmkgataeddsivalwrdtfadffgyrhpdhdtyefh
    itlsyivswfepeclprwqamldeeleklrvaapviqmrppafcefkdmnhfkelvvfdk
    rgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fsqA (A:)
    vskdldyistanhdqpprhlgsrfsaegeflpepgntvvchlvegsqtesaivstrqrfl
    dmpeasqlaftpvsslhmtvfqgviesrralpywpqtlpldtpidavtdyyrdrlstfpt
    lpafnmrvtglrpvgmvmkgataeddsivalwrdtfadffgyrhpdhdtyefhitlsyiv
    swfepeclprwqamldeeleklrvaapviqmrppafcefkdmnhfkelvvfd