PDB entry 2fsm

View 2fsm on RCSB PDB site
Description: mitogen activated protein kinase p38alpha (D176A+F327S) activating mutant form-B
Class: transferase
Keywords: mitogen activated protein kinase, p38, active mutants, lipids, MAP kinase insertion, autophosphorylation, TRANSFERASE
Deposited on 2006-01-23, released 2006-12-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.226
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered (333)
    Domains in SCOPe 2.04: d2fsmx_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2fsmX (X:)
    mahhhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavk
    klsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadl
    nnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglar
    htademtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlk
    lilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvlds
    dkritaaqalahayfaqyhdpddepvadpydqssesrdllidewksltydevisfvpppl
    dqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fsmX (X:)
    erptfyrqelnktiwevperyqnlspvggsvcaafdtktglrvavkklsrpfqsiihakr
    tyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnkltddhvqfliy
    qilrglkyihsadiihrdlkpsnlavnedcelkildfatrwyrapeimlnwmhynqtvdi
    wsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmp
    kmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqs
    sesrdllidewksltydevisfvppp