PDB entry 2fs7

View 2fs7 on RCSB PDB site
Description: Crystal Structure of Apo-Cellular Retinoic Acid Binding Protein Type II At 1.55 Angstroms Resolution
Class: transport protein
Keywords: CRABPII, Retinoic Acid, Retinoids, Beta Barrel, High Resolution, TRANSPORT PROTEIN
Deposited on 2006-01-21, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fs7a_
  • Chain 'B':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fs7b_
  • Heterogens: CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fs7A (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
    ltmtaddvvctrvyvre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fs7A (A:)
    nfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrtt
    einfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgelil
    tmtaddvvctrvyvre
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fs7B (B:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
    ltmtaddvvctrvyvre