PDB entry 2fs2

View 2fs2 on RCSB PDB site
Description: Structure of the E. coli PaaI protein from the phyenylacetic acid degradation operon
Class: hydrolase
Keywords: T820, PHENYLACETIC ACID, DEGRADATION, OPERON, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2006-01-20, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Escherichia coli [TaxId:562]
    Gene: paaI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76084 (2-End)
      • cloning artifact (0-1)
      • modified residue (12)
      • modified residue (29)
      • modified residue (38)
      • modified residue (44)
    Domains in SCOPe 2.07: d2fs2a1, d2fs2a2
  • Chain 'B':
    Compound: Phenylacetic acid degradation protein paaI
    Species: Escherichia coli [TaxId:562]
    Gene: paaI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76084 (2-End)
      • cloning artifact (0-1)
      • modified residue (12)
      • modified residue (29)
      • modified residue (38)
      • modified residue (44)
    Domains in SCOPe 2.07: d2fs2b2, d2fs2b3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fs2A (A:)
    slshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsl
    adtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqq
    ktvalfrgkshriggtitgeaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fs2A (A:)
    slshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsl
    adtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqq
    ktvalfrgkshr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fs2B (B:)
    slshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsl
    adtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqq
    ktvalfrgkshriggtitgeaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fs2B (B:)
    slshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsl
    adtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqq
    ktvalfrgkshriggtit