PDB entry 2frs

View 2frs on RCSB PDB site
Description: Crystal structure of the f15w mutant of apo-cellular retinoic acid binding protein type ii at 1.51 angstroms resolution
Class: transport protein
Keywords: CRABPII, Retinoic Acid, Retinoids, Beta Barrel, High Resolution, Mutant, TRANSPORT PROTEIN
Deposited on 2006-01-20, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (14)
    Domains in SCOPe 2.07: d2frsa_
  • Chain 'B':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (14)
    Domains in SCOPe 2.07: d2frsb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2frsA (A:)
    pnfsgnwkiirsenweellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
    ltmtaddvvctrvyvre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2frsA (A:)
    pnfsgnwkiirsenweellkvlgvkpaveikqegdtfyiktsttvrtteinfkvgeefee
    qtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeliltmtaddvvctrv
    yvre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2frsB (B:)
    pnfsgnwkiirsenweellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
    ltmtaddvvctrvyvre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2frsB (B:)
    pnfsgnwkiirsenweellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttein
    fkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeliltmt
    addvvctrvyvre