PDB entry 2frm

View 2frm on RCSB PDB site
Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum
Class: oxidoreductase
Keywords: apoenzyme structure, OXIDOREDUCTASE
Deposited on 2006-01-19, released 2007-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.245
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.07: d2frma3, d2frma4
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.07: d2frmb3, d2frmb4
  • Chain 'C':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668
      • see remark 999 (183)
    Domains in SCOPe 2.07: d2frmc3, d2frmc4
  • Chain 'D':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668
      • see remark 999 (183)
    Domains in SCOPe 2.07: d2frmd3, d2frmd4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2frmA (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2frmA (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2frmB (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2frmB (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2frmC (C:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2frmC (C:)
    ierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstskv
    igtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvicit
    npldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdgm
    vpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaav
    kmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllge
    sinevntiskvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2frmD (D:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2frmD (D:)
    ierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstskv
    igtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvicit
    npldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdgm
    vpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaav
    kmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllge
    sinevntisk