PDB entry 2frj

View 2frj on RCSB PDB site
Description: Nitrosyl Horse Heart Myoglobin, Nitrite/Dithionite Method
Class: oxygen storage/transport
Keywords: myoglobin, nitric oxide, nitrite, NO, NO2, heme, iron, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2006-01-19, released 2006-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.18
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2frjx_
  • Heterogens: SO4, HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2frjX (X:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2frjX (X:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq