PDB entry 2frh

View 2frh on RCSB PDB site
Description: Crystal Structure of Sara, A Transcription Regulator From Staphylococcus Aureus
Class: transcription
Keywords: winged-helix protein, divalent metal binding, transcription
Deposited on 2006-01-19, released 2006-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.266
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Staphylococcal accessory regulator A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sarA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A1N5 (4-126)
      • insertion (0-3)
    Domains in SCOPe 2.01: d2frha_
  • Chain 'B':
    Compound: Staphylococcal accessory regulator A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sarA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A1N5 (4-126)
      • insertion (0-3)
    Domains in SCOPe 2.01: d2frhb_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2frhA (A:)
gshmaitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdii
nhlnykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrite
anneiel

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2frhB (B:)
gshmaitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdii
nhlnykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrite
anneiel