PDB entry 2frf

View 2frf on RCSB PDB site
Description: Horse Heart Myoglobin, Nitrite Adduct, Crystal Soak
Class: oxygen storage/transport
Keywords: Myoglobin, Nitrite, NO, NO2, nitric oxide, heme, iron, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2006-01-19, released 2006-05-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.17
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2frfa_
  • Heterogens: SO4, NO2, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2frfA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2frfA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq