PDB entry 2fre

View 2fre on RCSB PDB site
Description: The crystal structure of the oxidoreductase containing FMN
Class: oxidoreductase
Keywords: Oxidoreductase, FMN, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-01-19, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P)H-flavin oxidoreductase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UJB5 (0-199)
      • modified residue (0)
      • modified residue (30)
      • modified residue (74)
      • modified residue (122)
      • modified residue (134)
    Domains in SCOPe 2.07: d2frea1
  • Chain 'B':
    Compound: NAD(P)H-flavin oxidoreductase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UJB5 (0-End)
      • modified residue (0)
      • modified residue (30)
      • modified residue (74)
      • modified residue (122)
      • modified residue (134)
    Domains in SCOPe 2.07: d2freb_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2freA (A:)
    mtnsnnrqseypvdplfldrwsprafdgspmpkehlltildaahwapsasnhqpwrfvya
    hkdsedwplfvellmegnqkwaknasvllfvisrdhtishegekkpsathsfdagaawfs
    lamqahllgyhahgmggifkdrivekldipdgfkveagvaigtltdksilpddlaerevp
    skrvpladvafegrftgkad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2freB (B:)
    mtnsnnrqseypvdplfldrwsprafdgspmpkehlltildaahwapsasnhqpwrfvya
    hkdsedwplfvellmegnqkwaknasvllfvisrdhtishegekkpsathsfdagaawfs
    lamqahllgyhahgmggifkdrivekldipdgfkveagvaigtltdksilpddlaerevp
    skrvpladvafegrftgkad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2freB (B:)
    mtnsnnrqseypvdplfldrwsprafdgspmpkehlltildaahwapsasnhqpwrfvya
    hkdsedwplfvellmegnqkwaknasvllfvisrdhtishegekkpsathsfdagaawfs
    lamqahllgyhahgmggifkdrivekldipdgfkveagvaigtltdksilpddlaerevp
    skrvpladvafegrftgk