PDB entry 2fra

View 2fra on RCSB PDB site
Description: Human Cathepsin S with CRA-27934, a Nitrile Inhibitor
Class: hydrolase
Keywords: papain, cysteine protease, drug design, 27934, HYDROLASE
Deposited on 2006-01-19, released 2006-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25774 (Start-216)
      • expression tag (187-188)
    Domains in SCOPe 2.07: d2fraa_
  • Chain 'B':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25774 (0-216)
      • expression tag (187-188)
    Domains in SCOPe 2.07: d2frab_
  • Heterogens: CRV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fraA (A:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fraA (A:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fraB (B:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fraB (B:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypei