PDB entry 2fr8

View 2fr8 on RCSB PDB site
Description: Structure of transhydrogenase (dI.R127A.NAD+)2(dIII.NADP+)1 asymmetric complex
Class: oxidoreductase
Keywords: nad(p) transhydrogenase subunits, nad+, nadp+, oxidoreductase
Deposited on 2006-01-19, released 2006-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.253
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60164 (0-End)
      • engineered (126)
    Domains in SCOPe 2.06: d2fr8a1, d2fr8a2
  • Chain 'B':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60164 (0-End)
      • engineered (126)
    Domains in SCOPe 2.06: d2fr8b1, d2fr8b2
  • Chain 'C':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntB, nntB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fr8c_
  • Heterogens: NAD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fr8A (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmpaisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr8A (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmpaisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitkqaeavlkelvktdiaitta
    lipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvps
    rvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fr8B (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmpaisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr8B (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmpaisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvkqaeavlkelvktdiaitt
    alipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvp
    srvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaiv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fr8C (C:)
    mnrsifnvilggfgseggvaaaggaagdrsvkagsaedaafimknaskviivpgygmava
    qaqhalremadvlkkegvevsyaihpvagrmpghmnvllaeanvpydevfeleeinssfq
    tadvafvigandvtnpaaktdpsspiygmpildvekagtvlfikrsmasgyagvenelff
    rnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr8C (C:)
    svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
    rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
    pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn