PDB entry 2fr5

View 2fr5 on RCSB PDB site
Description: Crystal Structure of Mouse Cytidine Deaminase Complexed with Tetrahydrouridine
Class: Hydrolase
Keywords: cytidine deaminase, zinc, tetrahydrouridine, protein-inhibitor complex, alternate conformation of arg68
Deposited on 2006-01-19, released 2006-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.169
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fr5a1
  • Chain 'B':
    Compound: Cytidine deaminase
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fr5b1
  • Chain 'C':
    Compound: Cytidine deaminase
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fr5c1
  • Chain 'D':
    Compound: Cytidine deaminase
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fr5d1
  • Heterogens: ZN, SO4, TYU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fr5A (A:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr5A (A:)
    epehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaerta
    iqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtvq
    ellpasfgpedlqkiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fr5B (B:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr5B (B:)
    epehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaerta
    iqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtvq
    ellpasfgpedlqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fr5C (C:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr5C (C:)
    vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
    aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
    qellpasfgpedlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fr5D (D:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr5D (D:)
    epehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaerta
    iqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtvq
    ellpasfgpedlqkiq