PDB entry 2fr5

View 2fr5 on RCSB PDB site
Description: Crystal Structure of Mouse Cytidine Deaminase Complexed with Tetrahydrouridine
Class: Hydrolase
Keywords: CYTIDINE DEAMINASE, TETRAHYDROURIDINE, PROTEIN-INHIBITOR COMPLEX, ALTERNATE CONFORMATION OF ARG68, Hydrolase
Deposited on 2006-01-19, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.169
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fr5a_
  • Chain 'B':
    Compound: Cytidine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fr5b_
  • Chain 'C':
    Compound: Cytidine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fr5c_
  • Chain 'D':
    Compound: Cytidine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fr5d_
  • Heterogens: ZN, SO4, TYU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fr5A (A:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr5A (A:)
    epehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaerta
    iqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtvq
    ellpasfgpedlqkiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fr5B (B:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr5B (B:)
    epehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaerta
    iqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtvq
    ellpasfgpedlqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fr5C (C:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr5C (C:)
    vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
    aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
    qellpasfgpedlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fr5D (D:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr5D (D:)
    epehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaerta
    iqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtvq
    ellpasfgpedlqkiq