PDB entry 2fr3

View 2fr3 on RCSB PDB site
Description: Crystal Structure of Cellular Retinoic Acid Binding Protein Type II in Complex with All-Trans-Retinoic Acid at 1.48 Angstroms Resolution
Class: transport protein
Keywords: CRABPII, Retinoic Acid, Retinoids, Beta Barrel, Crystallography, X-Ray, High Resolution, TRANSPORT PROTEIN
Deposited on 2006-01-18, released 2006-09-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.131
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2fr3a_
  • Heterogens: ACT, REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fr3A (A:)
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre