PDB entry 2fr2

View 2fr2 on RCSB PDB site
Description: Crystal Structure of Rv2717c from M. tuberculosis
Class: structural genomics, unknown function
Keywords: BETA BARREL, fatty acid binding, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, UNKNOWN FUNCTION
Deposited on 2006-01-18, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.18
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Rv2717c
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • GB NP_217233 (Start-163)
    Domains in SCOPe 2.08: d2fr2a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fr2A (A:)
mtrdlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravad
gkplhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglap
takevtaldrsyridgdelsyslqmravgqplqdhlaavlhrqrrshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2fr2A (A:)
dlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravadgkp
lhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglaptak
evtaldrsyridgdelsyslqmravgqplqdhlaavlhrqr