PDB entry 2fr1

View 2fr1 on RCSB PDB site
Description: The first ketoreductase of the erythromycin synthase (crystal form 2)
Class: oxidoreductase
Keywords: Short Chain Dehydrogenase/Reductase
Deposited on 2006-01-18, released 2006-04-04
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Erythromycin synthase, EryAI
    Species: Saccharopolyspora erythraea
    Gene: eryAI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fr1a1, d2fr1a2
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fr1A (A:)
    gshmstevdevsalryriewrptgageparldgtwlvakyagtadetstaarealesaga
    rvrelvvdarcgrdelaerlrsvgevagvlsllavdeaepeeaplalasladtlslvqam
    vsaelgcplwtvtesavatgpfervrnaahgalwgvgrvialenpavwgglvdvpagsva
    elarhlaavvsggagedqlalradgvygrrwvraaapatddewkptgtvlvtggtggvgg
    qiarwlarrgaphlllvsrsgpdadgagelvaelealgarttvaacdvtdresvrellgg
    igddvplsavfhaaatlddgtvdtltgerierasrakvlgarnlheltreldltafvlfs
    sfasafgapglggyapgnayldglaqqrrsdglpatavawgtwagsgmaegpvadrfrrh
    gviemppetacralqnaldraevcpividvrwdrfllaytaqrptrlfdeiddarraapq
    aaaepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr1A (A:)
    devsalryriewrptgageparldgtwlvakyagtadetstaarealesagarvrelvvd
    arcgrdelaerlrsvgevagvlsllavdeaepeeaplalasladtlslvqamvsaelgcp
    lwtvtesavatgpfervrnaahgalwgvgrvialenpavwgglvdvpagsvaelarhlaa
    vvsggagedqlalradgvygrrwvraaapatddewkptgtvlvtggtggvggqiarwlar
    rgaphlllvsrsgpdadgagelvaelealgarttvaacdvtdresvrellggigddvpls
    avfhaaatlddgtvdtltgerierasrakvlgarnlheltreldltafvlfssfasafga
    pglggyapgnayldglaqqrrsdglpatavawgtwafrrhgviemppetacralqnaldr
    aevcpividvrwdrfllaytaqrptrlfdeiddarr