PDB entry 2fqo

View 2fqo on RCSB PDB site
Description: Crystal structure of B. subtilis LuxS in complex with (2S)-2-Amino-4-[(2R,3R)-2,3-dihydroxy-3-N- hydroxycarbamoyl-propylmercapto]butyric acid
Class: lyase
Keywords: LuxS, Quorum sensing, LYASE
Deposited on 2006-01-18, released 2006-05-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-ribosylhomocysteine lyase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: luxS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fqoa_
  • Heterogens: CO, SO4, HYI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fqoA (A:)
    mpsvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehll
    aftirshaekydhfdiidispmgcqtgyylvvsgeptsaeivdlledtmkeaveiteipa
    anekqcgqaklhdlegakrlmrfwlsqdkeellkvfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fqoA (A:)
    vesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaft
    irshaekydhfdiidispmgcqtgyylvvsgeptsaeivdlledtmkeaveiteipaane
    kqcgqaklhdlegakrlmrfwlsqdkeellkvfg