PDB entry 2fql

View 2fql on RCSB PDB site
Description: Crystal structure of trimeric frataxin from the yeast Saccharomyces cerevisiae
Class: transport protein
Keywords: alpha/beta sandwich, metallochaperone, iron-storage, transport protein
Deposited on 2006-01-18, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frataxin homolog, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07540
      • engineered (21)
    Domains in SCOPe 2.07: d2fqla1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fqlA (A:)
    vesstdgqvvpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtl
    eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais
    ksq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fqlA (A:)
    vpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtleipafgtyv
    inkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekaisk