PDB entry 2fqd

View 2fqd on RCSB PDB site
Description: Crystal Structures of E. coli Laccase CueO under different copper binding situations
Class: oxidoreductase
Keywords: azurin-like domain, OXIDOREDUCTASE
Deposited on 2006-01-18, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Blue copper oxidase cueO
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fqda1, d2fqda2, d2fqda3
  • Heterogens: CU, C2O, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fqdA (A:)
    aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv
    diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt
    grqvamglaglvvieddeilklmlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavg
    wfgdtlltngaiypqhaaprgwlrlrllngcnarslnfatsdnrplyviasdggllpepv
    kvselpvlmgerfevlvevndnkpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasg
    alpdtlsslpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghm
    ghgnmnhmnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhih
    gtqfrilsengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedt
    gmmlgftv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fqdA (A:)
    erptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvd
    iynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktg
    rqvamglaglvvieddeilklmlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgw
    fgdtlltngaiypqhaaprgwlrlrllngcnarslnfatsdnrplyviasdggllpepvk
    vselpvlmgerfevlvevndnkpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasga
    lpdtlsslpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagfdfhhanking
    qafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdt
    vkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgftv