PDB entry 2fq9

View 2fq9 on RCSB PDB site
Description: Cathepsin S with nitrile inhibitor
Class: hydrolase
Keywords: papain, cysteine protease, antigen presentation, drug design, HYDROLASE
Deposited on 2006-01-17, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_004070 (0-217)
      • expression tag (187-188)
    Domains in SCOPe 2.08: d2fq9a_
  • Chain 'B':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_004070 (Start-217)
      • expression tag (187-188)
    Domains in SCOPe 2.08: d2fq9b_
  • Heterogens: CRJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fq9A (A:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fq9A (A:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fq9B (B:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fq9B (B:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei