PDB entry 2fq3

View 2fq3 on RCSB PDB site
Description: Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes
Class: transcription
Keywords: four-helix bundle, TRANSCRIPTION
Deposited on 2006-01-17, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.207
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription regulatory protein SWI3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SWI3, TYE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fq3a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fq3A (A:)
    mrgshhhhhhgmassyskwfnlekihsievqslpefftnripsktpevymryrnfmvnsy
    rlnpneyfsvttarrnvsgdaaalfrlhkfltkwglinyqvdsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fq3A (A:)
    skwfnlekihsievqslpefftnripsktpevymryrnfmvnsyrlnpneyfsvttarrn
    vsgdaaalfrlhkfltkwglinyqv