PDB entry 2fq0

View 2fq0 on RCSB PDB site
Description: Solution structure of major conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum
Class: lipid transport
Keywords: holo-pfacp, 4'-phosphopantetheine, lipid transport
Deposited on 2006-01-17, released 2006-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: malaria parasite P. falciparum
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fq0a_
  • Heterogens: PNS

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fq0A (A:)
    lkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdqda
    lkintvqdaidyieknnkq