PDB entry 2fpw

View 2fpw on RCSB PDB site
Description: Crystal Structure of the N-terminal Domain of E.coli HisB- Phosphoaspartate intermediate.
Class: hydrolase
Keywords: Histidinol phosphate phosphatase, HisB, bifunctional enzyme. , Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI
Deposited on 2006-01-17, released 2006-09-05
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.179
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine biosynthesis bifunctional protein hisB
    Species: Escherichia coli
    Gene: HisB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S5G5 (12-End)
      • modified residue (19)
    Domains in SCOP 1.73: d2fpwa1
  • Chain 'B':
    Compound: Histidine biosynthesis bifunctional protein hisB
    Species: Escherichia coli
    Gene: HisB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S5G5 (Start-175)
      • modified residue (19)
    Domains in SCOP 1.73: d2fpwb1
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fpwA (A:)
    mgsshhhhhhgssqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyk
    lvmitnqdglgtqsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvk
    lverylaeqamdransyvigdratdiqlaenmginglrydretlnwpmigeqltrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpwA (A:)
    sqkylfidrdgtlisepdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtqs
    fpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylmdransyv
    igdratdiqlaenmginglrydretlnwpmigeqlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fpwB (B:)
    mgsshhhhhhgssqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyk
    lvmitnqdglgtqsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvk
    lverylaeqamdransyvigdratdiqlaenmginglrydretlnwpmigeqltrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpwB (B:)
    qkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtq
    sfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdr
    ansyvigdratdiqlaenmginglrydretlnwpmigeqltrr