PDB entry 2fps

View 2fps on RCSB PDB site
Description: Crystal structure of the N-terminal domain of E.coli HisB- Apo Ca model.
Class: hydrolase
Keywords: histidinol phosphate phosphatase, HisB, bifunctional enzyme., Structural Genomics, Bacterial Structure Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, HYDROLASE
Deposited on 2006-01-17, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine biosynthesis bifunctional protein hisB
    Species: Escherichia coli [TaxId:83334]
    Gene: HisB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fpsa_
  • Chain 'B':
    Compound: Histidine biosynthesis bifunctional protein hisB
    Species: Escherichia coli [TaxId:83334]
    Gene: HisB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fpsb_
  • Heterogens: ZN, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fpsA (A:)
    mgsshhhhhhgssqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyk
    lvmitnqdglgtqsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvk
    lverylaeqamdransyvigdratdiqlaenmginglrydretlnwpmigeqltrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpsA (A:)
    sqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgt
    qsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylmdrans
    yvigdratdiqlaenmginglrydretlnwpmigeqlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fpsB (B:)
    mgsshhhhhhgssqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyk
    lvmitnqdglgtqsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvk
    lverylaeqamdransyvigdratdiqlaenmginglrydretlnwpmigeqltrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpsB (B:)
    qkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtq
    sfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdr
    ansyvigdratdiqlaenmginglrydretlnwpmigeqltrr