PDB entry 2fpn

View 2fpn on RCSB PDB site
Description: The crystal structure of the ywmB protein from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: ywmB, Bacillus subtilis, structural genomocs, domain swapping, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-01-16, released 2006-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.244
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ywmB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ywmB
    Database cross-references and differences (RAF-indexed):
    • GB CAB15694 (0-End)
      • modified residue (6)
      • modified residue (10)
      • modified residue (59)
      • modified residue (97)
      • modified residue (138)
      • modified residue (181)
      • modified residue (187)
    Domains in SCOPe 2.06: d2fpna1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fpnA (A:)
    ltplaqmaegmerqdvsidkwtlhakqnlsltekefyqkvqrlkqeyrqydwviaredkm
    ikaigtytdkknrtsfrlqlvttlkkhnptsyllyeqmsletpdswndtyeqferetlgi
    fqekvviftclnghlddnmnivlqkkanqllnefqarsvehvvepnfvsisaftdeweey
    imtskhkmnlqialrsagmggkhtvtvgtpivttey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpnA (A:)
    ltplaqmaegmerqdvsidkwtlhakqnlsltekefyqkvqrlkqeyrqydwviaredkm
    ikaigtytdkknrtsfrlqlvttlkkhnptsyllyeqmsletpdswndtyeqferetlgi
    fqekvviftclnghlddnmnivlqkkanqllnefqvehvvepnfvsisaftdeweeyimt
    skhkmnlqialrshtvtvgtpivtt