PDB entry 2fp4

View 2fp4 on RCSB PDB site
Description: Crystal structure of pig GTP-specific succinyl-CoA synthetase in complex with GTP
Class: ligase
Keywords: Active site phosphohistidine residue, LIGASE
Deposited on 2006-01-15, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O19069-2 (1-304)
      • cloning artifact (0)
      • modified residue (257)
    Domains in SCOPe 2.07: d2fp4a1, d2fp4a2, d2fp4a3
  • Chain 'B':
    Compound: Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53590 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2fp4b1, d2fp4b2
  • Heterogens: K, MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fp4A (A:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
    krkml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fp4B (B:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fp4B (B:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvt